PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01530.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 900aa    MW: 102136 Da    PI: 5.251
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01530.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.47.6e-09461505246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g+WT+eE+  l   +++ G  +W  Ia  +g++Rt+ qc  r+q 
  Rsa1.0_01530.1_g00003.1 461 GPWTAEEENNLRLIIQEKGFTDWLDIAVSLGTNRTPFQCLARYQR 505
                              89*****************************************96 PP

2Myb_DNA-binding38.82.1e-12513554143
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                              r+ WT+eEd++l  av+++G ++W t+a+ +  gR + qc +r
  Rsa1.0_01530.1_g00003.1 513 RKEWTPEEDDQLRSAVELYGEKDWQTVANALE-GRAGTQCSNR 554
                              789*****************************.*******987 PP

3Myb_DNA-binding47.64e-15618662247
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              g+++ eE+++l  av+++G  +W++Iar ++ gRt  qc+++w + 
  Rsa1.0_01530.1_g00003.1 618 GKFSSEEEKRLTVAVTLFGAQNWHKIARFVP-GRTSTQCREKWANC 662
                              79*****************************.***********885 PP

4Myb_DNA-binding56.85.2e-18670714247
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              g+WT+eEd +l +a +++  g+W++Ia++m+ +Rt++qc+ rw ++
  Rsa1.0_01530.1_g00003.1 670 GKWTKEEDAKLREAMAEHEIGNWSKIASHMP-RRTDNQCRRRWMQL 714
                              89*****************************.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.97358454IPR017877Myb-like domain
SMARTSM007170.4362456IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-9365381IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-9427460IPR009057Homeodomain-like
SuperFamilySSF466891.09E-13436504IPR009057Homeodomain-like
PROSITE profilePS512949.866455507IPR017930Myb domain
SMARTSM007171.3E-8459509IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-10461508IPR009057Homeodomain-like
PfamPF002492.8E-8461505IPR001005SANT/Myb domain
CDDcd001674.27E-6462507No hitNo description
SuperFamilySSF466893.52E-17492560IPR009057Homeodomain-like
PROSITE profilePS5129416.377508563IPR017930Myb domain
SMARTSM007173.1E-9512561IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-13513554IPR009057Homeodomain-like
PfamPF002495.2E-11513554IPR001005SANT/Myb domain
CDDcd001675.20E-9515554No hitNo description
SuperFamilySSF466892.77E-10606660IPR009057Homeodomain-like
PROSITE profilePS5129413.793611663IPR017930Myb domain
SMARTSM007171.2E-11616665IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-18618667IPR009057Homeodomain-like
PfamPF002491.1E-12618662IPR001005SANT/Myb domain
CDDcd001675.15E-10619661No hitNo description
SuperFamilySSF466899.64E-27643718IPR009057Homeodomain-like
PROSITE profilePS5129426.08664719IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-21668714IPR009057Homeodomain-like
SMARTSM007171.0E-15668717IPR001005SANT/Myb domain
PfamPF002491.1E-16670714IPR001005SANT/Myb domain
CDDcd001673.72E-15671714No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 900 aa     Download sequence    Send to blast
MNRGTLYDSD DDDDEEEDDD IGEDLEDLRR ACIISESNSD DVIPKPGYVE PDGGVGGGGG  60
EMPSDSENEE DDFEMLLSLK SQLAPSTDPP PMALPLPSDS ESDDDFELLR SLKSQLALSM  120
DARFPPMSLS DDDDEDDDSF ETLRAIRRRF SAYANLDLTQ VEARYKAQYK DGAFMNDSLG  180
KKKQVHASDN EPSSEILSRS NTCKSFPDQG ENLVTLPDSE GTQQAGDSID LHENSLKSTS  240
QSSSFPEAAQ AFVEAIRRNR AYQKFLRKKL TEIEAKIEQN EKHQKNVKIV VDFQASCKRI  300
TKQALSQGKD PRLQLISTPK CGPRDSSEDN DKKISPLTFG PPENPCVANC RMVLKTHPIS  360
VHRRSWSTEE NENLAKGLKQ QVQETLLIEA IERSSELEGS SDDIETINES IKNLEITPEM  420
IRQFLPKVNW DQLASMYFKD RSAAECEARW MSSEDPLINH GPWTAEEENN LRLIIQEKGF  480
TDWLDIAVSL GTNRTPFQCL ARYQRSLNAD ILRKEWTPEE DDQLRSAVEL YGEKDWQTVA  540
NALEGRAGTQ CSNRPIKLSK ELVCLVKYST GFINHTSCPC LVDVGLPQYA VINGNRVVGF  600
RMRYRWKKTL HPTRTRVGKF SSEEEKRLTV AVTLFGAQNW HKIARFVPGR TSTQCREKWA  660
NCLDPNVNHG KWTKEEDAKL REAMAEHEIG NWSKIASHMP RRTDNQCRRR WMQLYPHQVP  720
LLQEATRLRK EAIVGNFVDR ESQRPALLEC KFLALPEVPL EPEPETVGLK KKKRKARPKK  780
SDGECESEAT SAAKERRPKR RKGLERCSGD ACRQEDETFC ENIENLDNGG EVRSLEWCKE  840
NQDSVKEKKQ RRRRKSVVET SNNSTVTTDC SQGEVGVKKL TPRRRKVSTV VPIENQDAPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-204297118151MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-204297118151MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1769774KKKKRK
2881885PRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013685972.10.0PREDICTED: myb-like protein L
TrEMBLM4E0I30.0M4E0I3_BRARP; Uncharacterized protein
STRINGBra022280.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1